DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and CPR5

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_010590.3 Gene:CPR5 / 851898 SGDID:S000002712 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:89/163 - (54%)
Similarity:112/163 - (68%) Gaps:4/163 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRAL-CTGEKGYGYKGSPFHRVIPNFMCQGGDFT 68
            :|||||..|.:::|||||.|.....|:|.|||..| .:.:...||..|.|||||||||.||||||
Yeast    35 KVYFDINHGDKQIGRIVMGLYGLTTPQTVENFYQLTISRDPKMGYLNSIFHRVIPNFMIQGGDFT 99

  Fly    69 NQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVV 133
            :::|.||:||:||.|.||||::||...|.|||||.|.|||||||||.|....|||.||||||:|:
Yeast   100 HRSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKNTNGSQFFITTVPCPWLDGKHVVFGEVL 164

  Fly   134 EGMDIVQKVESYGSQDGKTS--KKVIIEDCGAL 164
            :|||:|..:|:. ..|.:..  |:|||.:.|.|
Yeast   165 DGMDVVHYIENV-KTDSRNMPVKEVIIVESGEL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 87/159 (55%)
CPR5NP_010590.3 cyclophilin 34..194 CDD:412213 87/159 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.