DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Ppig

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_113981.2 Gene:Ppig / 83624 RGDID:620315 Length:752 Species:Rattus norvegicus


Alignment Length:170 Identity:89/170 - (52%)
Similarity:109/170 - (64%) Gaps:9/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYG--------YKGSPFHRVIPNF 60
            ||.:||||...:..||:|.||.|||.|||.||||.|||||||.|        ||...||||:.:|
  Rat     8 PRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDF 72

  Fly    61 MCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNK 125
            |.|||||:..||.||.||||..|.||:|.:||....:|||||.|.:||||||||.|..|..||..
  Rat    73 MVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGH 137

  Fly   126 HVVFGKVVEGMDIVQKVESYGSQ-DGKTSKKVIIEDCGAL 164
            |||||:|:.|.::|:::|:..:. ..|...:|.|..||.|
  Rat   138 HVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 86/166 (52%)
PpigNP_113981.2 cyclophilin 8..175 CDD:412213 86/166 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.