DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and ROC7

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_200679.1 Gene:ROC7 / 835985 AraportID:AT5G58710 Length:204 Species:Arabidopsis thaliana


Alignment Length:167 Identity:109/167 - (65%)
Similarity:123/167 - (73%) Gaps:7/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYG-------YKGSPFHRVIPNFMC 62
            :||||:...|:..|||||.|....||||.||||||||||||.|       ||||.|||:||:||.
plant    36 KVYFDVEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKALHYKGSSFHRIIPSFML 100

  Fly    63 QGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHV 127
            ||||||:.||.||.||||.||.||||:|||||.|.|||||||.:||||||||.|..|:|||.:||
plant   101 QGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHV 165

  Fly   128 VFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            ||||||.|||:|.|||:.|:|.|....||:|.|.|.|
plant   166 VFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGEL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 107/163 (66%)
ROC7NP_200679.1 cyclophilin_ABH_like 35..200 CDD:238907 107/163 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38696
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.