DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Pnsl5

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_196816.1 Gene:Pnsl5 / 831151 AraportID:AT5G13120 Length:259 Species:Arabidopsis thaliana


Alignment Length:164 Identity:106/164 - (64%)
Similarity:127/164 - (77%) Gaps:4/164 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAG---GEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGD 66
            :|||||:.|   |:..||||:.|..|.||:|.||||||||||||:|||||.|||||.:||.||||
plant    91 KVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGSTFHRVIRDFMIQGGD 155

  Fly    67 FTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGK 131
            |...|||||:|:||..|.||||:|.|.|.|||||||||.|||||||||||.||:|||.:|||||:
plant   156 FEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQFFICTIKTSWLDGRHVVFGQ 220

  Fly   132 VVEGMDIVQKVESYGSQDG-KTSKKVIIEDCGAL 164
            |:|||::|:.:|...:..| :..|||:|.|||.|
plant   221 VIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 103/160 (64%)
Pnsl5NP_196816.1 cyclophilin_ABH_like 90..252 CDD:238907 103/160 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.