DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and AT4G34960

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_195222.1 Gene:AT4G34960 / 829648 AraportID:AT4G34960 Length:224 Species:Arabidopsis thaliana


Alignment Length:168 Identity:89/168 - (52%)
Similarity:117/168 - (69%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKG-------YGYKGSPFHRVIPNFMC 62
            ||:.|:...|::|||||:.|...|||||.||||||||||||       ..|||:||||:|..|:.
plant    48 RVFLDVDIDGQRLGRIVIGLYGTVVPKTVENFRALCTGEKGKTSSGKPLHYKGTPFHRIISGFVI 112

  Fly    63 QGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHV 127
            ||||..:.:|....||||..||||||:::|:.||:::|||.|.::|||||||.|.|.:||:.:||
plant   113 QGGDIIHGDGKSSDSIYGGTFPDENFKIQHSHAGMVAMANTGPDSNGSQFFITTVKASWLEGEHV 177

  Fly   128 VFGKVVEGMDIVQKVE-SYGSQDGKTSKKVIIEDCGAL 164
            |.|||::|||.|..:| ..|:..||..|||:|.|.|.:
plant   178 VLGKVIQGMDNVFAIEGGAGTYSGKPRKKVVIADSGEI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 88/164 (54%)
AT4G34960NP_195222.1 cyclophilin 48..213 CDD:412213 88/164 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.