DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and AT4G32420

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001190889.1 Gene:AT4G32420 / 829377 AraportID:AT4G32420 Length:837 Species:Arabidopsis thaliana


Alignment Length:167 Identity:77/167 - (46%)
Similarity:105/167 - (62%) Gaps:8/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYG--------YKGSPFHRVIPNF 60
            |:|:.|::..|:....:|.||..:|.|||:||||||||||||.|        ||||.|||::...
plant     7 PQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSFFHRIMKGS 71

  Fly    61 MCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNK 125
            ..|.|||.|:|||.|.|||..|||||:.:|:|...|:|||:.|..:..||.|.|.......||..
plant    72 SAQAGDFVNRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADRDKFGSHFHITFRPNQQLDRN 136

  Fly   126 HVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCG 162
            :|||||:::|.:|::|:|..|.::||.:..|.|..||
plant   137 NVVFGKLIQGKEILKKIERVGDEEGKPTVSVKIIRCG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 75/165 (45%)
AT4G32420NP_001190889.1 cyclophilin 7..173 CDD:381853 75/165 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.