DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and ROC4

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001154684.1 Gene:ROC4 / 825376 AraportID:AT3G62030 Length:313 Species:Arabidopsis thaliana


Alignment Length:161 Identity:111/161 - (68%)
Similarity:125/161 - (77%) Gaps:1/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTN 69
            :||||:..|||..|||||.|..:|||||.|||||||||||.||||||.|||:|.:||.||||||.
plant   149 KVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTE 213

  Fly    70 QNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVE 134
            .|||||.||||.||.||||.|||||.|:|||||||.|||||||||||.||:||||||||||:|:|
plant   214 GNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIE 278

  Fly   135 GMDIVQKVESYGSQDGKTSKK-VIIEDCGAL 164
            ||.:|:.:||..::.....|| ..|..||.|
plant   279 GMKLVRTLESQETRAFDVPKKGCRIYACGEL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 108/157 (69%)
ROC4NP_001154684.1 cyclophilin_ABH_like 149..307 CDD:238907 108/157 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.