DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and CYP71

DIOPT Version :10

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_190046.2 Gene:CYP71 / 823585 AraportID:AT3G44600 Length:631 Species:Arabidopsis thaliana


Alignment Length:139 Identity:75/139 - (53%)
Similarity:87/139 - (62%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGN 81
            ||.|.|:|..:..|||.|||...|  ..|| |....|||||..||.|.||... :||||:||:|.
plant   484 LGDIHMKLYPEECPKTVENFTTHC--RNGY-YDNHLFHRVIRGFMIQTGDPLG-DGTGGQSIWGR 544

  Fly    82 KFPDE-NFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESY 145
            :|.|| :..|:|.....|||||||.|||||||||.|..|.||||||.|||:||:|||:||.:|..
plant   545 EFEDEFHKSLRHDRPFTLSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVKGMDVVQGIEKV 609

  Fly   146 GSQDGKTSK 154
                 ||.|
plant   610 -----KTDK 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 75/139 (54%)
CYP71NP_190046.2 WD40 <68..286 CDD:475233
WD40 repeat 73..111 CDD:293791
WD40 repeat 117..154 CDD:293791
WD40 repeat 157..200 CDD:293791
WD40 repeat 207..253 CDD:293791
cyclophilin_WD40 479..626 CDD:238908 75/139 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.