DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and AT3G22920

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_188932.1 Gene:AT3G22920 / 821864 AraportID:AT3G22920 Length:232 Species:Arabidopsis thaliana


Alignment Length:175 Identity:75/175 - (42%)
Similarity:103/175 - (58%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYG-------YKGSPFHRVIP 58
            |:.|:|:||:...|:..||||:||.:|:.|:||||||.|||||:|.|       ||||.|..::|
plant     1 MANPKVFFDLTVDGKPAGRIVIELFADLTPRTAENFRGLCTGERGIGKCGKPIHYKGSTFDHIVP 65

  Fly    59 NFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKH-TGAGVLSMANAGANTNGSQFFI-CTGKTTW 121
            :.|..|||...:|    ..|:..:..||.|.|.| .|.|::||    |::|||||.| .......
plant    66 DLMWCGGDIIFEN----EPIHSEELDDEYFILNHEDGPGIISM----ADSNGSQFQIHMKDYGLQ 122

  Fly   122 LDNKHVVFGKVVEGMDIVQKVES--YGSQDGKTSKKVIIEDCGAL 164
            :|..|||.||||||:|:::.:|.  ..:.....||.|:|.|||.|
plant   123 VDGDHVVIGKVVEGLDLMRNIEKEVITTTTRTPSKPVVIADCGEL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 71/168 (42%)
AT3G22920NP_188932.1 cyclophilin 1..168 CDD:381853 75/175 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.