DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and AT2G38730

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_181407.1 Gene:AT2G38730 / 818455 AraportID:AT2G38730 Length:199 Species:Arabidopsis thaliana


Alignment Length:168 Identity:90/168 - (53%)
Similarity:115/168 - (68%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGE-----KGYGYKGSPFHRVIPNFMCQ 63
            |.|:||::.||...|||.|||.:|:.||||||||..||||     |..|||...|||||.:||.|
plant    32 PVVFFDVSIGGIPAGRIKMELFADIAPKTAENFRQFCTGELRKAGKPLGYKECQFHRVIKDFMVQ 96

  Fly    64 GGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVV 128
            .|||...:|:|..||||:||.||||..||||.|:|||||:|.||||.||||...|..||||||||
plant    97 SGDFLKNDGSGCMSIYGHKFEDENFTAKHTGPGLLSMANSGPNTNGCQFFITCAKCDWLDNKHVV 161

  Fly   129 FGKVV-EGMDIVQKVESYG-SQDGKTSKKVIIEDCGAL 164
            ||:|: :|:.:::|:|:.. ..:.:....|:|.:||.:
plant   162 FGRVLGDGLLVMRKIENVAIGPNNRPKLAVVITECGEM 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 88/164 (54%)
AT2G38730NP_181407.1 PLN03149 14..199 CDD:178694 90/166 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.