DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and ROC3

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001318231.1 Gene:ROC3 / 816161 AraportID:AT2G16600 Length:173 Species:Arabidopsis thaliana


Alignment Length:168 Identity:116/168 - (69%)
Similarity:134/168 - (79%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYG-------YKGSPFHRVIPNFM 61
            |:||||:..||:..|||||||.:|..|:||||||||||||:|.|       ||||.||||||.||
plant     5 PKVYFDMTVGGKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFHRVIPKFM 69

  Fly    62 CQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKH 126
            |||||||..|||||.||||:||.||||..||||.|:|||||||||||||||||||.||:|||.||
plant    70 CQGGDFTAGNGTGGESIYGSKFKDENFIKKHTGPGILSMANAGANTNGSQFFICTEKTSWLDGKH 134

  Fly   127 VVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            ||||:||||:::|:.:|..||..|:|||.|:|.|||.:
plant   135 VVFGQVVEGLNVVRDIEKVGSDSGRTSKPVVIADCGQI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 114/164 (70%)
ROC3NP_001318231.1 cyclophilin_ABH_like 5..170 CDD:238907 114/164 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 245 1.000 Domainoid score I551
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I999
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - mtm1140
orthoMCL 1 0.900 - - OOG6_100528
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.