DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Ppil1

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_081121.1 Gene:Ppil1 / 68816 MGIID:1916066 Length:166 Species:Mus musculus


Alignment Length:149 Identity:73/149 - (48%)
Similarity:95/149 - (63%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFT 68
            |.||.:.:     :|.||:||.....|||.:||..|  ..:|| |.|:.|||:|.:||.||||.|
Mouse    12 PNVYLETS-----MGVIVLELYWKHAPKTCKNFAEL--ARRGY-YNGTKFHRIIKDFMIQGGDPT 68

  Fly    69 NQNGTGGRSIYGNKFPDE-NFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKV 132
            . .|.||.||||.:|.|| :.:||.||||:|:|||||.:|||||||:....|.|||.||.:||:|
Mouse    69 G-TGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRV 132

  Fly   133 VEGMDIVQKV--ESYGSQD 149
            .:|:.:|.:|  ....|||
Mouse   133 CQGIGMVNRVGMVETNSQD 151

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 73/149 (49%)
Ppil1NP_081121.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 71/146 (49%)
Cyclosporin A binding. /evidence=ECO:0000250 54..65 6/10 (60%)