DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Ppib

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_071981.1 Gene:Ppib / 64367 RGDID:620312 Length:208 Species:Rattus norvegicus


Alignment Length:162 Identity:104/162 - (64%)
Similarity:123/162 - (75%) Gaps:3/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTN 69
            :||||...|.|.:||:...|....||||.:||.||.|||||:|||.|.|||||.:||.||||||.
  Rat    37 KVYFDFQIGDEPVGRVTFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTR 101

  Fly    70 QNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVE 134
            .:||||:||||.:||||||:|||.|.|.:||||||.:||||||||.|.||:|||.||||||||:|
  Rat   102 GDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLE 166

  Fly   135 GMDIVQKVES--YGSQDGKTSKKVIIEDCGAL 164
            |||:|:|||:  ..|:| |..|.|||.|||.:
  Rat   167 GMDVVRKVENTKTDSRD-KPLKDVIIVDCGKI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 102/158 (65%)
PpibNP_071981.1 cyclophilin_ABH_like 37..195 CDD:238907 102/158 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.