DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and ppifb

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001032199.2 Gene:ppifb / 641328 ZFINID:ZDB-GENE-051030-126 Length:192 Species:Danio rerio


Alignment Length:161 Identity:118/161 - (73%)
Similarity:137/161 - (85%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFT 68
            |.|:|||||..:.|||:..||.:|||||||||||||||||.|:|||||.||||||.|||||||||
Zfish    31 PVVFFDIAADNQPLGRVTFELNADVVPKTAENFRALCTGEHGFGYKGSIFHRVIPQFMCQGGDFT 95

  Fly    69 NQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVV 133
            |.|||||:||||.:||||||:|||||.|:|||||||.|||||||||||.||.|||.:|||||.|.
Zfish    96 NHNGTGGKSIYGPRFPDENFKLKHTGPGILSMANAGVNTNGSQFFICTAKTEWLDGRHVVFGSVK 160

  Fly   134 EGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            ||||:|:|||:.||:.|:|::::.|.|||.|
Zfish   161 EGMDVVRKVEALGSRSGRTAQRISITDCGEL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 115/157 (73%)
ppifbNP_001032199.2 cyclophilin_ABH_like 31..189 CDD:238907 115/157 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38696
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R284
SonicParanoid 1 1.000 - - X209
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.650

Return to query results.
Submit another query.