DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Ppie

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_062362.1 Gene:Ppie / 56031 MGIID:1917118 Length:301 Species:Mus musculus


Alignment Length:161 Identity:111/161 - (68%)
Similarity:131/161 - (81%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGD 66
            |.|:||.||..|.:..|||.|.|||||||.||||||.|||.|||:|:|||.|||:||.|||||||
Mouse   138 SNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGD 202

  Fly    67 FTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGK 131
            |||.|||||:||||.||.||||.|||||.|:|||||:|.||||||||:...||.|||.||||||:
Mouse   203 FTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGE 267

  Fly   132 VVEGMDIVQKVESYGSQDGKTSKKVIIEDCG 162
            |.||:|:::::|:.||:|||..:||:|.|||
Mouse   268 VTEGLDVLRQIEAQGSKDGKPKQKVMIADCG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 108/157 (69%)
PpieNP_062362.1 RRM <5..194 CDD:223796 37/55 (67%)
RRM_PPIE 8..80 CDD:240793
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..141 1/2 (50%)
cyclophilin_ABH_like 140..298 CDD:238907 108/157 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.