DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and ppil4

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001121802.1 Gene:ppil4 / 554886 ZFINID:ZDB-GENE-030131-6251 Length:454 Species:Danio rerio


Alignment Length:160 Identity:60/160 - (37%)
Similarity:88/160 - (55%) Gaps:20/160 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGN 81
            ||.||::|.::..||.:.||..||. .|.|.|  ...|.|..:|:.|.||.|. .|.||.|::..
Zfish     9 LGDIVIDLYTEERPKASLNFLKLCK-IKYYNY--CLIHNVQRDFIIQTGDPTG-TGRGGESVFCK 69

  Fly    82 KFPDEN--FE------LKHTGAGVLSMANAGANTNGSQFFICTGKTT-WLDNKHVVFGKVVEGMD 137
            .:.|:.  ||      :||...|.:||.|.|::.:||||.|.||:.. :||..|.|||:|.||||
Zfish    70 LYGDQARFFESEKMPRIKHRKKGTVSMVNNGSDQHGSQFLITTGENVDYLDGVHTVFGEVTEGMD 134

  Fly   138 IVQKV-ESYGS------QDGKTSKKVIIED 160
            ::.|: |::..      ||.:.:..||::|
Zfish   135 VLAKINETFVDNDFIPFQDIRINHTVILDD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 60/160 (38%)
ppil4NP_001121802.1 cyclophilin_RRM 4..169 CDD:238902 60/160 (38%)
RRM 172..>320 CDD:223796
RRM_PPIL4 237..319 CDD:240681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.