DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and ppib

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001017063.1 Gene:ppib / 549817 XenbaseID:XB-GENE-855964 Length:208 Species:Xenopus tropicalis


Alignment Length:162 Identity:102/162 - (62%)
Similarity:123/162 - (75%) Gaps:3/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTN 69
            :|||||..|.|.:||:|:.|....||||.|||..|.|||||:|||||.|||||.:||.||||||.
 Frog    37 KVYFDIKIGDEDVGRVVIGLFGKTVPKTVENFVTLATGEKGFGYKGSKFHRVIKDFMIQGGDFTR 101

  Fly    70 QNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVE 134
            .:||||:||||::||||||:|:|.|...:||||||.:||||||||.|.||.|||.|||||||::|
 Frog   102 GDGTGGKSIYGDRFPDENFKLRHYGPNWVSMANAGKDTNGSQFFITTVKTPWLDGKHVVFGKILE 166

  Fly   135 GMDIVQKVESYGSQDG--KTSKKVIIEDCGAL 164
            |.|:|:|:|| ...||  |..|.|:|.|||.:
 Frog   167 GKDVVEKIES-TKTDGRDKPLKDVVIADCGTI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 100/158 (63%)
ppibNP_001017063.1 cyclophilin_ABH_like 36..195 CDD:238907 100/158 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.