DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and PPIL1

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:159 Identity:75/159 - (47%)
Similarity:98/159 - (61%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFT 68
            |.||.:.:     :|.||:||.....|||.:||..|  ..:|| |.|:.|||:|.:||.||||.|
Human    12 PNVYLETS-----MGIIVLELYWKHAPKTCKNFAEL--ARRGY-YNGTKFHRIIKDFMIQGGDPT 68

  Fly    69 NQNGTGGRSIYGNKFPDE-NFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKV 132
            . .|.||.||||.:|.|| :.:||.||||:|:|||||.:|||||||:....|.|||.||.:||:|
Human    69 G-TGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRV 132

  Fly   133 VEGMDIVQKV--ESYGSQDGKTSKKVIIE 159
            .:|:.:|.:|  ....|||.......||:
Human   133 CQGIGMVNRVGMVETNSQDRPVDDVKIIK 161

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 75/159 (47%)
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 72/154 (47%)
Cyclosporin A binding. /evidence=ECO:0000305|PubMed:16595688 54..65 6/10 (60%)