DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and T22F3.12

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001041170.1 Gene:T22F3.12 / 4363086 WormBaseID:WBGene00044705 Length:174 Species:Caenorhabditis elegans


Alignment Length:168 Identity:75/168 - (44%)
Similarity:103/168 - (61%) Gaps:10/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTN 69
            :|:.||.|.|..||::|.||.::..|||.|||..||||..|:|||...|:||||.|....|||..
 Worm     4 KVFMDITADGAPLGKLVFELNTEKCPKTCENFVKLCTGPPGFGYKNCVFYRVIPTFCACSGDFET 68

  Fly    70 QNG--TGGRSIYGNK-FPDENFELKHTGAGVLSMANAG-ANTNGSQFFICTGKTTWLDNKHVVFG 130
            ||.  .||:|.:|.| |.|||||:.|...|:|.|.|.| .|||.|:|::...:|.|::..||.||
 Worm    69 QNARRDGGKSTFGTKYFDDENFEILHDKKGILGMDNYGWENTNSSRFYVTFRETPWMNRFHVAFG 133

  Fly   131 KVVEGMDIVQKVESY------GSQDGKTSKKVIIEDCG 162
            ::|||.|::..:|:.      |.|.|:|...::|.:||
 Worm   134 ELVEGFDVLDAIENLGILEGNGPQQGRTKANIVIANCG 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 73/166 (44%)
T22F3.12NP_001041170.1 cyclophilin 4..171 CDD:294131 73/166 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.