DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and CG5071

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster


Alignment Length:164 Identity:51/164 - (31%)
Similarity:88/164 - (53%) Gaps:8/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFT 68
            |..:.|:...||..||:::|:|||..|:.|:||.||...|:||||:|....:.........|||.
  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTVFQAWGGESIITGDFE 578

  Fly    69 NQNGTGGRSIYGNKF--PDENFELKHTGAGVLSMANAGANTN---GSQFFICTGKTTWLDNKHVV 128
            :|||.||.|.:.:::  |||.....|.|...:.......:.:   ||||.:...:   :.:...:
  Fly   579 SQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLNE---MRSFTAI 640

  Fly   129 FGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCG 162
            ||.:|:|:::|.::.:.|:..|:.:.:.||.:||
  Fly   641 FGFIVQGIELVDRIAASGNALGRPALRSIIRNCG 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 49/162 (30%)
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 49/162 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.