DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and ppil3

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001002146.1 Gene:ppil3 / 415236 ZFINID:ZDB-GENE-040625-159 Length:161 Species:Danio rerio


Alignment Length:128 Identity:62/128 - (48%)
Similarity:80/128 - (62%) Gaps:5/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGN 81
            ||.:.:||..:..||:.|||.|||.|  |: |.|..|||.|..|:.|.||.|. .|.||.||:|.
Zfish     9 LGDMKIELFCEKAPKSCENFLALCAG--GF-YNGCIFHRNIKGFIVQTGDPTG-TGKGGTSIWGR 69

  Fly    82 KFPDENFE-LKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVE 143
            ||.||..| |||...||::|||.|.|||.||||....|...||.|:.||||:::|::.:.::|
Zfish    70 KFEDEFSEHLKHNVRGVVAMANNGPNTNASQFFFTYAKQPHLDMKYTVFGKIIDGLETLDEIE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 62/128 (48%)
ppil3NP_001002146.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 62/128 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.