DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Ppid

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001004279.1 Gene:Ppid / 361967 RGDID:1303174 Length:370 Species:Rattus norvegicus


Alignment Length:169 Identity:102/169 - (60%)
Similarity:124/169 - (73%) Gaps:8/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYG--------YKGSPFHRVIPNF 60
            |||:||:..|||::||||:||.:|:|||||||||||||||||.|        :||.||||:|..|
  Rat    16 PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPFHRIIKKF 80

  Fly    61 MCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNK 125
            |.|||||:|||||||.||||.||.||||..||...|:|||||||.|||||||||.|..|..||.|
  Rat    81 MIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGK 145

  Fly   126 HVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            |||||:|::|:.:.:.:|:......|.:|..:|.:||.|
  Rat   146 HVVFGQVIKGLGVARMLENVEVNGEKPAKLCVIAECGEL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 99/165 (60%)
PpidNP_001004279.1 cyclophilin_ABH_like 16..182 CDD:238907 99/165 (60%)
Chaperone activity. /evidence=ECO:0000250 185..215 102/169 (60%)
3a0801s09 192..>330 CDD:273380
Interaction with HSP90AB1. /evidence=ECO:0000250 214..370
TPR repeat 223..251 CDD:276809
TPR repeat 272..302 CDD:276809
TPR repeat 307..335 CDD:276809
TPR repeat 341..364 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.