DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Ppial4g

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_341364.2 Gene:Ppial4g / 361080 RGDID:1559682 Length:195 Species:Rattus norvegicus


Alignment Length:159 Identity:105/159 - (66%)
Similarity:127/159 - (79%) Gaps:0/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQ 70
            ::|:|.|.||.|||:.:||.:|.||:||||||:|.|||||:|||||.|||:||.||||||..|..
  Rat     6 MFFNITADGEPLGRVSLELFADKVPRTAENFRSLTTGEKGFGYKGSSFHRIIPGFMCQGGKVTCH 70

  Fly    71 NGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEG 135
            |||||:||||.||.:::|.|||||.|:|||||||.|||||||||||.||..||.|.|||||...|
  Rat    71 NGTGGKSIYGEKFENDSFILKHTGPGILSMANAGPNTNGSQFFICTAKTERLDGKCVVFGKGRGG 135

  Fly   136 MDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            .:||:.:|.:||::||||||:.|.|||.|
  Rat   136 TNIVEAMEHFGSRNGKTSKKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 102/155 (66%)
Ppial4gXP_341364.2 cyclophilin 7..162 CDD:294131 102/154 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.