DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Ppil2

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001017383.1 Gene:Ppil2 / 360746 RGDID:1309484 Length:521 Species:Rattus norvegicus


Alignment Length:138 Identity:71/138 - (51%)
Similarity:86/138 - (62%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNK 82
            |.:.:||..|:.|||.|||..||  :|.| |.|:.|||.|.||:.||||.|. .||||.|.:|..
  Rat   289 GDLNLELHCDLTPKTCENFIKLC--KKQY-YDGTIFHRSIRNFVIQGGDPTG-TGTGGESYWGKP 349

  Fly    83 FPDE-NFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYG 146
            |.|| ...|.|||.|||||||:|.|||.|||||......:||.||.:||:||.|.|.:..:|:..
  Rat   350 FKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITFRSCAYLDKKHTIFGRVVGGFDTLTAMENVE 414

  Fly   147 SQDGKTSK 154
            | |.||.:
  Rat   415 S-DPKTDR 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 71/138 (51%)
Ppil2NP_001017383.1 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 71/138 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.