DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and CG17266

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster


Alignment Length:169 Identity:90/169 - (53%)
Similarity:114/169 - (67%) Gaps:10/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGY-------GYKGSPFHRVIPNFM 61
            |.|:||||.|..::||::.||.:|.||:||||||..||||  |       ||||:.|||||.:||
  Fly    17 PVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPDGVPIGYKGASFHRVIKDFM 79

  Fly    62 CQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKH 126
            .|||||...:|||..|||||.|.||||.|||...|:|||||:|..|||.||||...|..:||.||
  Fly    80 IQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKH 144

  Fly   127 VVFGKVVEGMDIVQKVESYGS-QDGKTSKKVIIEDCGAL 164
            ||||:|::|:.|::|:|:..: .:.|....|.|..||.:
  Fly   145 VVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 88/165 (53%)
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 88/165 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447250
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.