DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and ppiab

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001315353.1 Gene:ppiab / 335519 ZFINID:ZDB-GENE-030131-7459 Length:164 Species:Danio rerio


Alignment Length:164 Identity:122/164 - (74%)
Similarity:136/164 - (82%) Gaps:0/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGG 65
            |:.|:|:|||...|::.||||||||:|||||||||||||||||||:|||||.||||||.||||||
Zfish     1 MANPKVFFDITIDGKEAGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPQFMCQGG 65

  Fly    66 DFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFG 130
            ||||.|||||:|||||||.||||.|||.|.|.|||||||.|||||||||||..|.|||.||||||
Zfish    66 DFTNHNGTGGKSIYGNKFEDENFTLKHGGKGTLSMANAGPNTNGSQFFICTADTNWLDGKHVVFG 130

  Fly   131 KVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            |||:|:|:|..:|..||..||.|.||:|.:||.|
Zfish   131 KVVDGLDVVDAIEKKGSSSGKCSAKVVIANCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 118/157 (75%)
ppiabNP_001315353.1 cyclophilin_ABH_like 4..162 CDD:238907 118/157 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100528
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R284
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.