DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Ppil1

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001029360.1 Gene:Ppil1 / 309651 RGDID:1309119 Length:166 Species:Rattus norvegicus


Alignment Length:149 Identity:73/149 - (48%)
Similarity:95/149 - (63%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFT 68
            |.||.:.:     :|.||:||.....|||.:||..|  ..:|| |.|:.|||:|.:||.||||.|
  Rat    12 PNVYLETS-----MGIIVLELYWKHAPKTCKNFAEL--ARRGY-YNGTKFHRIIKDFMIQGGDPT 68

  Fly    69 NQNGTGGRSIYGNKFPDE-NFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKV 132
            . .|.||.||||.:|.|| :.:||.||||:|:|||||.:|||||||:....|.|||.||.:||:|
  Rat    69 G-TGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRV 132

  Fly   133 VEGMDIVQKV--ESYGSQD 149
            .:|:.:|.:|  ....|||
  Rat   133 CQGIGMVNRVGMVETNSQD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 73/149 (49%)
Ppil1NP_001029360.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 71/146 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.