DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and Ppic

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001004215.1 Gene:Ppic / 291463 RGDID:1303221 Length:212 Species:Rattus norvegicus


Alignment Length:145 Identity:91/145 - (62%)
Similarity:109/145 - (75%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTN 69
            :|:||:..|.:.:||||:.|...|||:|.|||..|.|||||||||||.|||||.:||.||||||.
  Rat    39 KVFFDVRIGDKDVGRIVIGLFGKVVPRTVENFVTLATGEKGYGYKGSIFHRVIKDFMIQGGDFTA 103

  Fly    70 QNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVE 134
            ::||||.||||..||||||:|||.|.|.:||||||.:||||||||...|..|||.||||||||::
  Rat   104 RDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPAWLDGKHVVFGKVLD 168

  Fly   135 GMDIVQKVESYGSQD 149
            ||.:|..:|...:.|
  Rat   169 GMTVVHSIELQATDD 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 91/145 (63%)
PpicNP_001004215.1 cyclophilin_ABH_like 38..197 CDD:238907 91/145 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.