DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and cyp4

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_596532.1 Gene:cyp4 / 2541395 PomBaseID:SPBP8B7.25 Length:201 Species:Schizosaccharomyces pombe


Alignment Length:170 Identity:99/170 - (58%)
Similarity:119/170 - (70%) Gaps:14/170 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQ 70
            ||||:..|.|.|||:.:.|....|||||||||||.|||||:||:||.|||||||||.||||.|..
pombe    29 VYFDLQQGDEFLGRVTIGLFGKTVPKTAENFRALATGEKGFGYEGSIFHRVIPNFMIQGGDITKG 93

  Fly    71 NGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEG 135
            :||||:||||::||||||:|.|...|:|||||||.::|||||||.|.||.|||..|||||:|:.|
pombe    94 DGTGGKSIYGSRFPDENFKLSHQRPGLLSMANAGPDSNGSQFFITTVKTPWLDGHHVVFGEVLSG 158

  Fly   136 MDIVQKVESYGSQDGKTSK----KVI---------IEDCG 162
            .|||:|: |....|.:...    |:|         :||.|
pombe   159 YDIVKKI-SKAETDNRDKPLEDVKIIKSGQLSQENVEDDG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 98/168 (58%)
cyp4NP_596532.1 cyclophilin 27..186 CDD:294131 96/157 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.