DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and CG32236

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster


Alignment Length:184 Identity:41/184 - (22%)
Similarity:75/184 - (40%) Gaps:49/184 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAA--GGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQG-- 64
            |.:|||:|.  ..:.:||::::|.:::.|:....|..:.|......::   |.|:..|...:.  
  Fly   228 PIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGCHR---FVRIFSNLWMEAEL 289

  Fly    65 -----GDFTNQNG-----------TGGRSI---YGNKFPDENFELKHTGAGVLSMANAGANTNGS 110
                 ....|.:.           ||..|.   |...||.          |:||           
  Fly   290 VPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQ----------GLLS----------- 333

  Fly   111 QFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
              :..:.|.:.:..:.|:||:|..|:.::|....:|:::|||.|.||:..||.|
  Fly   334 --YTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 38/180 (21%)
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 40/182 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.