DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and cyn-7

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_506749.1 Gene:cyn-7 / 180027 WormBaseID:WBGene00000883 Length:171 Species:Caenorhabditis elegans


Alignment Length:171 Identity:119/171 - (69%)
Similarity:131/171 - (76%) Gaps:7/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYG-------YKGSPFHRVIP 58
            ||.|||:|||...|:..|||||||.:|:|||||||||||||||||.|       :|||.|||:||
 Worm     1 MSRPRVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIP 65

  Fly    59 NFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLD 123
            .||.||||||..|||||.||||.|||||||:.||||.|||||||||.||||||||:||.||.|||
 Worm    66 EFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLD 130

  Fly   124 NKHVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            .||||||:||||:|||.|||..||..|....:.:|.|||.|
 Worm   131 GKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSECLIADCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 114/164 (70%)
cyn-7NP_506749.1 cyclophilin_ABH_like 4..169 CDD:238907 114/164 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 237 1.000 Domainoid score I1296
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I2047
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - mtm4827
orthoMCL 1 0.900 - - OOG6_100528
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R284
SonicParanoid 1 1.000 - - X209
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.