DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and cyn-13

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001255925.1 Gene:cyn-13 / 178487 WormBaseID:WBGene00000889 Length:331 Species:Caenorhabditis elegans


Alignment Length:162 Identity:107/162 - (66%)
Similarity:125/162 - (77%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDF 67
            |||||..:..|...:||||:|||:||.||||||||.|||||:|:||:||.|||:||.||.|||||
 Worm   138 LPRVYLGVKIGIRYIGRIVIELRTDVTPKTAENFRCLCTGERGFGYEGSIFHRIIPKFMLQGGDF 202

  Fly    68 TNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKV 132
            |..:||||:||||.||.||||.|:||..|.:||||.|||||||||||||.||.|||.||||||.|
 Worm   203 TKGDGTGGKSIYGTKFDDENFTLRHTMPGTVSMANCGANTNGSQFFICTEKTDWLDGKHVVFGHV 267

  Fly   133 VEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            ||||:||::||..|:..||....|.|.:.|.:
 Worm   268 VEGMNIVRQVEQQGTPSGKPQMVVKIVESGEI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 105/157 (67%)
cyn-13NP_001255925.1 RRM <10..>115 CDD:223796
RRM_PPIE 13..85 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 105/157 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563773at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.