DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and cyn-2

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_499828.1 Gene:cyn-2 / 176807 WormBaseID:WBGene00000878 Length:172 Species:Caenorhabditis elegans


Alignment Length:171 Identity:118/171 - (69%)
Similarity:135/171 - (78%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LPR--VYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYG-------YKGSPFHRVIP 58
            :||  |:|||..||:|.|||||||.:|:|||||||||||||||||.|       :|||.|||:||
 Worm     1 MPRVKVFFDITIGGKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIP 65

  Fly    59 NFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLD 123
            .||.||||||..|||||.||:|.||.||||:.||||.|||||||.||||||||||:||.||||||
 Worm    66 EFMIQGGDFTEGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCGANTNGSQFFLCTVKTTWLD 130

  Fly   124 NKHVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            .||||||||:||||:|:.:||.||:||..|...:|.|||.:
 Worm   131 GKHVVFGKVIEGMDVVKAIESKGSEDGAPSAPCVIADCGEM 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 116/166 (70%)
cyn-2NP_499828.1 cyclophilin_ABH_like 5..169 CDD:238907 114/163 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 237 1.000 Domainoid score I1296
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I2047
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - mtm4827
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.