DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and PPIE

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001181936.1 Gene:PPIE / 10450 HGNCID:9258 Length:314 Species:Homo sapiens


Alignment Length:153 Identity:104/153 - (67%)
Similarity:121/153 - (79%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGD 66
            |.|:||.||..|.:..|||.|.|||||||.||||||.|||.|||:|:|||.|||:||.|||||||
Human   138 SNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGD 202

  Fly    67 FTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGK 131
            |||.|||||:||||.||.||||.|||||.|:|||||:|.||||||||:...||.|||.||||||:
Human   203 FTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGE 267

  Fly   132 VVEGMDIVQKVESYGSQDGKTSK 154
            |.||:|:::::|.  :.|.|.||
Human   268 VTEGLDVLRQIEV--APDTKASK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 103/151 (68%)
PPIENP_001181936.1 RRM <5..>84 CDD:223796
RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 140..279 CDD:238907 98/138 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D563773at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.