DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and CWC27

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_005860.2 Gene:CWC27 / 10283 HGNCID:10664 Length:472 Species:Homo sapiens


Alignment Length:116 Identity:56/116 - (48%)
Similarity:72/116 - (62%) Gaps:5/116 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNK 82
            |.|.:||.|...||...||..||.  :.| |..:.||||:|.|:.||||.|. .|:||.||||..
Human    22 GDIDIELWSKEAPKACRNFIQLCL--EAY-YDNTIFHRVVPGFIVQGGDPTG-TGSGGESIYGAP 82

  Fly    83 FPDE-NFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKV 132
            |.|| :..|:....|:::|||||::.||||||...|:...|:|||.:||||
Human    83 FKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 56/116 (48%)
CWC27NP_005860.2 cyclophilin_CeCYP16-like 8..178 CDD:238906 56/116 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..386
DUF5401 <302..>472 CDD:375164
CWC27_CTD 376..428 CDD:412084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.