DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and LOC100911252

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_038964534.1 Gene:LOC100911252 / 100911252 RGDID:6493676 Length:164 Species:Rattus norvegicus


Alignment Length:161 Identity:120/161 - (74%)
Similarity:133/161 - (82%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFT 68
            |.|:|||.|.||.|||:..||.:|.|||||||||||.|||||:|||||.|||:||.|||||||||
  Rat     4 PTVFFDITADGEPLGRVCFELFADEVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFT 68

  Fly    69 NQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVV 133
            ..|||||:||||.||.||||.|||||.|:|||||||.|||||||||||.||.|||.||||||||.
  Rat    69 CHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVK 133

  Fly   134 EGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164
            |||.||:.:|.:||::||||||:.|.|||.|
  Rat   134 EGMSIVEAMERFGSRNGKTSKKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 117/157 (75%)
LOC100911252XP_038964534.1 cyclophilin_ABH_like 4..162 CDD:238907 117/157 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.