DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and LOC100488106

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_004912407.1 Gene:LOC100488106 / 100488106 -ID:- Length:147 Species:Xenopus tropicalis


Alignment Length:145 Identity:107/145 - (73%)
Similarity:120/145 - (82%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGN 81
            :|.|:||||||||||||||||||||.|||:|||.|.|||:||.||||||||||.|||||:|||||
 Frog     1 MGLIIMELRSDVVPKTAENFRALCTHEKGFGYKNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGN 65

  Fly    82 KFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYG 146
            ||.||||:|:|||.|:|||||||||||||||||||.||:|||.||||||.|::|||:|:..|..|
 Frog    66 KFADENFQLRHTGPGILSMANAGANTNGSQFFICTAKTSWLDGKHVVFGTVIDGMDVVKNTEKLG 130

  Fly   147 SQDGKTSKKVIIEDC 161
            ||.|        .||
 Frog   131 SQSG--------NDC 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 107/145 (74%)
LOC100488106XP_004912407.1 cyclophilin 2..134 CDD:294131 104/131 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D563773at33208
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.