DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7768 and LOC100333141

DIOPT Version :9

Sequence 1:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_002667876.2 Gene:LOC100333141 / 100333141 -ID:- Length:245 Species:Danio rerio


Alignment Length:139 Identity:90/139 - (64%)
Similarity:108/139 - (77%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTN 69
            :|:|||..||.::||||:.|..:|.|.|.:||.:|.|||||||||||.|||||.:||.||||||.
Zfish    72 KVFFDITVGGHEVGRIVIGLFGEVAPLTVQNFVSLATGEKGYGYKGSKFHRVIKDFMIQGGDFTA 136

  Fly    70 QNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVE 134
            .:||||:|||||.|.||||.|:|.|||.:||||||.:||||||||...:..|||.||||||||:|
Zfish   137 GDGTGGKSIYGNMFADENFRLRHLGAGWVSMANAGPDTNGSQFFITLARAPWLDGKHVVFGKVLE 201

  Fly   135 GMDIVQKVE 143
            ||.:|..:|
Zfish   202 GMAVVHTIE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 90/139 (65%)
LOC100333141XP_002667876.2 cyclophilin 71..230 CDD:294131 90/139 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.