DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nuf and Rab11fip3

DIOPT Version :9

Sequence 1:NP_001246751.1 Gene:nuf / 39572 FlyBaseID:FBgn0013718 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_220262.5 Gene:Rab11fip3 / 303002 RGDID:1308952 Length:1110 Species:Rattus norvegicus


Alignment Length:329 Identity:97/329 - (29%)
Similarity:169/329 - (51%) Gaps:58/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DNLNEQLELLQRKVDDLSDTQNIAEDRTTRTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQK 298
            :::.:::..|:|:|.:|......|.::..|.:.|...|..|.:.||||.:|.|.||:|::.||.:
  Rat   814 EDIADKVIFLERRVSELEKDSAAAGEQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETR 878

  Fly   299 RHREILARVEREASLQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARDQ 363
            :.:|:|.::|||.|::.||.|.:::..:.|.:.||.....|:.       ::.|.||:.:...|:
  Rat   879 KQKELLCKMEREKSIEIENLQARLQQLDEENSELRSCTPCLKA-------NIERLEEEKQKMLDE 936

  Fly   364 IGVLQQEHEEQAQALR---------RH--EQEKKSTEELMLELGRELQ------------RAREE 405
            |..|.|...|:.:..|         ||  :::|::|:||:.:|.::|:            |.|..
  Rat   937 IEELTQRLSEEQENKRKMGDKLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEMEQRRGRSS 1001

  Fly   406 S-GARAMPTTSPESIRLEELHQELEEMRQKNRTLEEQNEELQATMLTNQATMLTNGVEQGRHLLN 469
            | |.:...:.:.||    ||.||:..::|.||.|:|||:||...::|...        ||...|.
  Rat  1002 SLGLQEYNSRARES----ELEQEVRRLKQDNRNLKEQNDELNGQIITLSI--------QGAKSLF 1054

  Fly   470 GT--LNSLAQELEEMSQAQDSVDSATLASLSQLQQAFQEKEDENVRLKHYIDTILLNIVENYPQL 532
            .|  ..|||.|:..:|:             .:|.:|.|::|:.|.||:.|||.|::.|:|..|.:
  Rat  1055 STSFSESLAAEISSVSR-------------DELMEAIQKQEEINFRLQDYIDRIIVAILETNPSI 1106

  Fly   533 LEVK 536
            ||||
  Rat  1107 LEVK 1110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nufNP_001246751.1 VirB5_like 436..>506 CDD:295212 19/71 (27%)
RBD-FIP 496..536 CDD:255374 16/39 (41%)
Rab11fip3XP_220262.5 EFh 516..573 CDD:238008
EF-hand_7 517..573 CDD:290234
BCAS2 <833..943 CDD:283380 35/116 (30%)
TPR_MLP1_2 894..1042 CDD:285204 43/158 (27%)
SynN 894..996 CDD:294095 24/108 (22%)
WD40_alt 1001..1044 CDD:290784 17/46 (37%)
RBD-FIP 1070..1110 CDD:255374 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6622
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4553
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1419449at2759
OrthoFinder 1 1.000 - - FOG0002087
OrthoInspector 1 1.000 - - otm45566
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15726
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.