DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nuf and Rab11fip3

DIOPT Version :9

Sequence 1:NP_001246751.1 Gene:nuf / 39572 FlyBaseID:FBgn0013718 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_036016358.1 Gene:Rab11fip3 / 215445 MGIID:2444431 Length:1118 Species:Mus musculus


Alignment Length:320 Identity:97/320 - (30%)
Similarity:163/320 - (50%) Gaps:58/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LQRKVDDLSDTQNIAEDRTTRTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQKRHREILARV 307
            |:|:|.:|......|.::..|.:.|...|..|.:.||||.:|.|.||:|::.||.::.:|:|.::
Mouse   831 LERRVSELEKDSAAAGEQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKM 895

  Fly   308 EREASLQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARDQIGVLQQEHE 372
            |||.|::.||.|.:::..:.|.:.||.....|:.       ::.|.||:.:...|:|..|.|...
Mouse   896 EREKSIEIENLQARLQQLDEENSELRSCTPCLKA-------NIERLEEEKQKMLDEIEELTQRLS 953

  Fly   373 EQAQALR---------RH--EQEKKSTEELMLELGRELQ------------RAREES-GARAMPT 413
            |:.:..|         ||  :::|::|:||:.:|.::|:            |.|..| |.:...:
Mouse   954 EEQENKRKMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEYNS 1018

  Fly   414 TSPESIRLEELHQELEEMRQKNRTLEEQNEELQATMLTNQATMLTNGVEQGRHLLNGT--LNSLA 476
            .:.||    ||.||:..::|.||.|:|||:||...::|...        ||...|..|  ..|||
Mouse  1019 RARES----ELEQEVRRLKQDNRNLKEQNDELNGQIITLSI--------QGAKSLFSTSFSESLA 1071

  Fly   477 QELEEMSQAQDSVDSATLASLSQLQQAFQEKEDENVRLKHYIDTILLNIVENYPQLLEVK 536
            .|:..:|:             .:|.:|.|::|:.|.||:.|||.|::.|:|..|.:||||
Mouse  1072 AEISSVSR-------------DELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK 1118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nufNP_001246751.1 VirB5_like 436..>506 CDD:295212 19/71 (27%)
RBD-FIP 496..536 CDD:255374 16/39 (41%)
Rab11fip3XP_036016358.1 PTZ00449 <12..331 CDD:185628
EF-hand_7 500..557 CDD:404394
Smc <853..1116 CDD:224117 87/294 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836879
Domainoid 1 1.000 105 1.000 Domainoid score I6651
eggNOG 1 0.900 - - E1_KOG0982
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4611
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1419449at2759
OrthoFinder 1 1.000 - - FOG0002087
OrthoInspector 1 1.000 - - otm43504
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15726
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4084
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.