DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nuf and rab11fip3

DIOPT Version :9

Sequence 1:NP_001246751.1 Gene:nuf / 39572 FlyBaseID:FBgn0013718 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_012826083.2 Gene:rab11fip3 / 100486615 XenbaseID:XB-GENE-6042108 Length:1811 Species:Xenopus tropicalis


Alignment Length:353 Identity:95/353 - (26%)
Similarity:170/353 - (48%) Gaps:92/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 LSAEICD--NLNEQLELLQRKVDDLSDTQNIAEDRTTRTKTEYAVLQARYHMLEEQYRESELRAE 290
            ||...||  :|.:::..|::::.:|........::..|.:.|...|..|.|.||||.::.|||::
 Frog  1505 LSDMACDETDLTDKVLFLEQRISELERDAATTSEQQNRLRQENLQLLHRAHALEEQLKDQELRSD 1569

  Fly   291 ERLAEEQKRHREILARVERE------------ASLQNENCQMKIRATEIEATALREEAARLRVLC 343
            |..:||.::||:.|.::||:            ..|:|||.:::.:..:|:||..|.|        
 Frog  1570 EVQSEEIRKHRDELRKMERDNGYQLSSLKARVQELENENSELRSQVPDIKATVQRLE-------- 1626

  Fly   344 DKQANDLHRTEEQLELARDQIGVLQQEHEEQAQ---------ALRRHEQEK--KSTEELMLELGR 397
                      ||:|:| :|::.|||.:.:||..         :..:|.|:.  :..:|::.||.|
 Frog  1627 ----------EEKLKL-QDEVEVLQGQVKEQCDSNQKLSGQLSKEKHNQQSHMERCQEVIEELRR 1680

  Fly   398 ELQR------------------AREESGARAMPTTSPESIRLEELHQELEEMRQKNRTLEEQNEE 444
            ||::                  |.:|..:|.         |..||..|:..::|:.|.|:|||||
 Frog  1681 ELEQMQLVRLDMEHRLGLGNSAALQEYNSRT---------REAELEHEVRRLKQEQRALKEQNEE 1736

  Fly   445 LQATMLTNQATMLTNGVEQGRHLLNGTL-NSLAQELEEMSQAQDSVDSATLASLSQLQQAFQEKE 508
            |       ...::...::..::|.:.|. :|||.|:..:|:             .:|.:|.|::|
 Frog  1737 L-------NGQIINLSIQGAKNLFSTTFSDSLAAEISNVSR-------------DELMEAIQKQE 1781

  Fly   509 DENVRLKHYIDTILLNIVENYPQLLEVK 536
            :.|:||:.|||.|::.|:|..|.:||||
 Frog  1782 EINLRLQDYIDRIIVAIMETNPAILEVK 1809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nufNP_001246751.1 VirB5_like 436..>506 CDD:295212 17/70 (24%)
RBD-FIP 496..536 CDD:255374 16/39 (41%)
rab11fip3XP_012826083.2 PHA03247 <136..615 CDD:223021
EF-hand_7 1226..1284 CDD:404394
Smc <1458..1759 CDD:224117 72/288 (25%)
RBD-FIP 1769..1809 CDD:401421 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1419449at2759
OrthoFinder 1 1.000 - - FOG0002087
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15726
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.