DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and SOX7

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_113627.1 Gene:SOX7 / 83595 HGNCID:18196 Length:388 Species:Homo sapiens


Alignment Length:293 Identity:93/293 - (31%)
Similarity:129/293 - (44%) Gaps:91/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRAL 201
            |.|..|:|||||||||::.:|:::|..||.:||:|:||.||..||.|..|:|||::|||:|||..
Human    40 GSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQ 104

  Fly   202 HMKEHPDYKYRPRRK---------------------PKNPL---TAGPQGGLQMQAGGMGQQKLG 242
            ||:::|:||||||||                     .:|.|   .:|.:|.|. :....|:...|
Human   105 HMQDYPNYKYRPRRKKQAKRLCKRVDPGFLLSSLSRDQNALPEKRSGSRGALG-EKEDRGEYSPG 168

  Fly   243 A-----------GPGAGAGGYNPFH--------QLPPYFAPSHHL-------------DQGYP-- 273
            .           ||..|.||..|..        ..||..:|...|             :.|:|  
Human   169 TALPSLRGCYHEGPAGGGGGGTPSSVDTYPYGLPTPPEMSPLDVLEPEQTFFSSPCQEEHGHPRR 233

  Fly   274 VPYFGG--FDP-LALSKLHQSQAAAAAAVNNQGQQQGQAP--------PQLPPTSLSSFYSGIYS 327
            :|:..|  :.| .|.|.||.|....:.|:       ||:|        |..||:  .::||    
Human   234 IPHLPGHPYSPEYAPSPLHCSHPLGSLAL-------GQSPGVSMMSPVPGCPPS--PAYYS---- 285

  Fly   328 GISAPSLY-AAHSANAAGLYPSSSTSSPGSSPG 359
                |:.| ..||...|.|   ...|.|...||
Human   286 ----PATYHPLHSNLQAHL---GQLSPPPEHPG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 39/70 (56%)
SOX7NP_113627.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..46 2/5 (40%)
SOX-TCF_HMG-box 44..115 CDD:238684 39/70 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..197 13/57 (23%)
Sox_C_TAD 198..386 CDD:288887 33/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.