DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox18

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_017209261.1 Gene:sox18 / 797246 ZFINID:ZDB-GENE-080725-1 Length:431 Species:Danio rerio


Alignment Length:401 Identity:112/401 - (27%)
Similarity:159/401 - (39%) Gaps:108/401 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LHYSQSLAAMGGS--PNGPAGQGVNGSSG------MGHHMSSHMTPHHMHQAVSAQQTLSPNSSI 99
            ::.|:|......|  |:..|.:|..|:|.      .||......|........|..:|:|..:  
Zfish     1 MNISESSCCQEASSQPSQVAERGTWGASSSTPGPERGHGFDRSRTTELAPVPGSGTRTVSRTA-- 63

  Fly   100 GSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDN 164
             :....||..|.......|.||.|           ..|.|..|:|||||||||::.:|:::|..|
Zfish    64 -AEARTGSPDSTRPGALTLGSSEG-----------KSGGESRIRRPMNAFMVWAKDERKRLAIQN 116

  Fly   165 PKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK--PKNPLTAGPQG 227
            |.:||:.:||.||..||.|:..:||||::||:|||..|:::||:||||||||  ||......|  
Zfish   117 PDLHNAVLSKMLGQSWKALSTLDKRPFVEEAERLRLQHLQDHPNYKYRPRRKKQPKKMKRVEP-- 179

  Fly   228 GLQMQAGGMGQQKLGAGPGAGAGGYNP----FHQLPP--YFAPSH-----HLDQ-GYPVPYF--- 277
            ||.:|....|      |||   ..|:|    .|.|||  :|...|     .|:. |.|.|..   
Zfish   180 GLLLQGLAHG------GPG---DAYSPHRHAHHLLPPLGHFRDLHPSGAPELESFGLPTPEMSPL 235

  Fly   278 -----GGFDPLALSKLHQSQAAAAAAVN---NQGQQQGQAPPQ---------------------- 312
                 ||.|.:......|.....::.:|   :...|.|..|..                      
Zfish   236 DVLEEGGGDSVFFPPHMQEDVGLSSWINYHQHPNHQPGHHPHHNSHNLQHSHPHLNQKSPLACLP 300

  Fly   313 ---------------------LPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGS 356
                                 ||.:|.:.:|..|| |.|.|.  .|.:::...|.|...||:...
Zfish   301 LQEKCLVVESPNPGGLYPNMTLPESSKAGYYGQIY-GSSQPQ--PAFTSHLGQLSPPPETSAVAQ 362

  Fly   357 SPGTITPNGMD 367
                :.|..:|
Zfish   363 ----VAPPSLD 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 37/70 (53%)
sox18XP_017209261.1 SOX-TCF_HMG-box 93..164 CDD:238684 37/70 (53%)
Sox_C_TAD 207..429 CDD:288887 31/170 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.