DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox4

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001039084.1 Gene:sox4 / 733893 XenbaseID:XB-GENE-480727 Length:387 Species:Xenopus tropicalis


Alignment Length:333 Identity:105/333 - (31%)
Similarity:144/333 - (43%) Gaps:73/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QQTLSPNSSIGSAGSLGSQSSLGSNGSGL-----NSSSGHQSAGMHSLATSPG----QEGHIKRP 145
            |||  .|:....|..|..:||  .:|:|:     :|.:...:|.....|..|.    ..||||||
 Frog     3 QQT--NNAENTEAALLAGESS--ESGAGIELDMASSPTPGATASTGGKADDPSWCKTPSGHIKRP 63

  Fly   146 MNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYK 210
            ||||||||:::||:|.:.:|.|||:|||||||..||.|.:.:|.|||.||:|||..||.::||||
 Frog    64 MNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKQLKDGDKIPFIREAERLRLKHMADYPDYK 128

  Fly   211 YRPRRKPKN------PLTAGPQGGLQMQAGGMGQQKLGAGPGAGAG-----------GYNPFHQL 258
            ||||:|.|:      ....|..||.....|..|..|......:|..           |...|.:.
 Frog   129 YRPRKKVKSGGSKPGDKACGSPGGSSSPTGSTGSGKPPVKKSSGTKLCNKPHTKLVLGARAFPEQ 193

  Fly   259 PPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQ----------QGQ----- 308
            .|.. |.||                   .|::|:.||:.....:.:.          ||.     
 Frog   194 QPCI-PDHH-------------------SLYKSRTAASGRQEKKPKHRVYIFGGAGYQGSPSVAV 238

  Fly   309 -APPQLPPTS------LSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTS-SPGSSPGTITPNG 365
             |.|.|..:|      ||.:..|..|..::|...:.|........|:.||| |..||....:|:.
 Frog   239 PASPTLSSSSAEASDPLSLYEDGSGSAQNSPGSPSEHDGYTRASSPAPSTSHSSSSSSAASSPSS 303

  Fly   366 MDGSMDSA 373
            ...|..|:
 Frog   304 ASSSSSSS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 45/70 (64%)
sox4NP_001039084.1 SOX-TCF_HMG-box 59..130 CDD:238684 45/70 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.