DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment D and SRY

DIOPT Version :9

Sequence 1:	NP_001261830.1	Gene:	D / 39570	FlyBaseID:	FBgn0000411	Length:	382	Species:	Drosophila melanogaster
Sequence 2:	NP_003131.1	Gene:	SRY / 6736	HGNCID:	11311	Length:	204	Species:	Homo sapiens

Alignment Length:	111	Identity:	56/111 - (50%)
Similarity:	76/111 - (68%)	Gaps:	12/111 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   113 SNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLG 177
            |..|.....:|..|.|        ..:..:|||||||:||||.|||::|.:||:|.||||||:||
Human    39 SCNSKYQCETGENSKG--------NVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLG 95

  Fly   178 AEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK----PKN 219
            .:||:|.|:||.||..||::|:|:|.:::|:||||||||    |||
Human    96 YQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKN 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
D	NP_001261830.1	SOX-TCF_HMG-box	141..212	CDD:238684	42/70 (60%)
SRY	NP_003131.1	Sufficient for interaction with KPNB1. /evidence=ECO:0000269\|PubMed:15297880	59..136		48/76 (63%)
		SOX-TCF_HMG-box	59..130	CDD:238684	42/70 (60%)
		Required for nuclear localization. /evidence=ECO:0000269\|PubMed:12764225, ECO:0000269\|PubMed:15746192	61..77		13/15 (87%)
		Sufficient for interaction with EP300. /evidence=ECO:0000269\|PubMed:15297880	107..139		16/31 (52%)
		Required for nuclear localization. /evidence=ECO:0000269\|PubMed:15297880	130..136		5/5 (100%)
		Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269\|PubMed:15469996	138..155		3/4 (75%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	175..204
		Necessary for interaction with SLC9A3R2. /evidence=ECO:0000269\|PubMed:9054412	198..204
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000028
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10270
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	3.010