DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and SOX12

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens


Alignment Length:133 Identity:69/133 - (51%)
Similarity:86/133 - (64%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 ATSPG----QEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFID 193
            |..||    ..||||||||||||||:.:||:|....|.|||:|||||||..|:||.:|||.||:.
Human    27 AREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVR 91

  Fly   194 EAKRLRALHMKEHPDYKYRPRRKPKN-PLTAGPQ------GGLQMQAG----GMGQQKLGAGP-G 246
            ||:|||..||.::||||||||:|.|. |..|.|:      ||.:::.|    |.|.::...|| |
Human    92 EAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRGGRRAAGGPLG 156

  Fly   247 AGA 249
            .||
Human   157 GGA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 46/70 (66%)
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 4/12 (33%)
SOX-TCF_HMG-box 39..110 CDD:238684 46/70 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 25/60 (42%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.