DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and SOX15

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_008873.1 Gene:SOX15 / 6665 HGNCID:11196 Length:233 Species:Homo sapiens


Alignment Length:227 Identity:97/227 - (42%)
Similarity:116/227 - (51%) Gaps:56/227 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEG-----HIKRPMNAFMVWSR 154
            |.||...|.||...::.    :..:||||.|.   ...|.||...|     .:|||||||||||.
Human     4 PGSSQDQAWSLEPPAAT----AAASSSSGPQE---REGAGSPAAPGTLPLEKVKRPMNAFMVWSS 61

  Fly   155 LQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKN 219
            .||||:|:.|||||||||||||||:||||.|.|||||::|||||||.|::::||||||||||.|:
Human    62 AQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKS 126

  Fly   220 PLTAGP----QGGLQMQAGG--MGQQKLGAGPGAG-------------AGGYNPFH--------- 256
            . .|||    ||...:.:||  .|.......|..|             .|.|...|         
Human   127 S-GAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPC 190

  Fly   257 ------------QLPPYFAPSHHLDQGYPVPY 276
                        .||.|   :|:|..|.|.||
Human   191 SLPQSDPRLQGELLPTY---THYLPPGSPTPY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 53/70 (76%)
SOX15NP_008873.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 15/50 (30%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 1..47 15/49 (31%)
SOX-TCF_HMG-box 48..119 CDD:238684 53/70 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..153 19/40 (48%)
Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 138..183 8/44 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..233 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.