Sequence 1: | NP_001261830.1 | Gene: | D / 39570 | FlyBaseID: | FBgn0000411 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008873.1 | Gene: | SOX15 / 6665 | HGNCID: | 11196 | Length: | 233 | Species: | Homo sapiens |
Alignment Length: | 227 | Identity: | 97/227 - (42%) |
---|---|---|---|
Similarity: | 116/227 - (51%) | Gaps: | 56/227 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 PNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEG-----HIKRPMNAFMVWSR 154
Fly 155 LQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKN 219
Fly 220 PLTAGP----QGGLQMQAGG--MGQQKLGAGPGAG-------------AGGYNPFH--------- 256
Fly 257 ------------QLPPYFAPSHHLDQGYPVPY 276 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
D | NP_001261830.1 | SOX-TCF_HMG-box | 141..212 | CDD:238684 | 53/70 (76%) |
SOX15 | NP_008873.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..48 | 15/50 (30%) | |
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 | 1..47 | 15/49 (31%) | |||
SOX-TCF_HMG-box | 48..119 | CDD:238684 | 53/70 (76%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 113..153 | 19/40 (48%) | |||
Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 | 138..183 | 8/44 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 208..233 | 6/12 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10270 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |