DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and SOX11

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_003099.1 Gene:SOX11 / 6664 HGNCID:11191 Length:441 Species:Homo sapiens


Alignment Length:402 Identity:113/402 - (28%)
Similarity:150/402 - (37%) Gaps:162/402 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSP------------GQEGHIKRPMNAFMV 151
            :..|.||.::|:|..  ..|::..|      ..:|.||            ...||||||||||||
Human     2 VQQAESLEAESNLPR--EALDTEEG------EFMACSPVALDESDPDWCKTASGHIKRPMNAFMV 58

  Fly   152 WSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK 216
            ||:::||:|.:.:|.|||:|||||||..||:|.:|||.|||.||:|||..||.::||||||||:|
Human    59 WSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKK 123

  Fly   217 PKNPLTAGPQ-----------GGLQMQAGGMG---------------------QQKLGAGPGAGA 249
            ||...:|.|.           ||.....||.|                     ..|.|||..|.:
Human   124 PKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQS 188

  Fly   250 GGYNPFHQLPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAA---------------- 298
            |.|.                        |..|...|..|..|.:....|                
Human   189 GDYG------------------------GAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDD 229

  Fly   299 ---------VNNQGQQQ-------------GQAPPQL-----------PPTSLSSFYS------- 323
                     :..:..::             ||.|.||           .||..||..|       
Human   230 DDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLY 294

  Fly   324 -----GIYSG---------------------ISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTIT 362
                 |..||                     ::.|:|..|.|.:.:    :||:||.|||.|:..
Human   295 DEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVS----TSSSSSSGSSSGSSG 355

  Fly   363 PNGMDGSMDSAL 374
            .:..|...|.:|
Human   356 EDADDLMFDLSL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 47/70 (67%)
SOX11NP_003099.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 6/20 (30%)
SOX-TCF_HMG-box 48..119 CDD:238684 47/70 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..216 29/123 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..292 10/51 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..359 12/43 (28%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q7M6Y2 409..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.