DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and SOX4

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_003098.1 Gene:SOX4 / 6659 HGNCID:11200 Length:474 Species:Homo sapiens


Alignment Length:305 Identity:109/305 - (35%)
Similarity:147/305 - (48%) Gaps:61/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QQTLSPNSSIGSAGSLGSQSSLGSNGSGL-----NSSSGHQSAGMHSLATSPG----QEGHIKRP 145
            |||   |::..:...|..:||  .:|:||     :|.:...:|.....|..|.    ..||||||
Human     3 QQT---NNAENTEALLAGESS--DSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRP 62

  Fly   146 MNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYK 210
            ||||||||:::||:|.:.:|.|||:|||||||..||||.:|:|.|||.||:|||..||.::||||
Human    63 MNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYK 127

  Fly   211 YRPRRK-------------------PKNPLTAGPQGGLQMQAGGMGQQKL-GAGPGAGAGGYNPF 255
            ||||:|                   .|.....|..||.....||.|.... |.|.||..||.|. 
Human   128 YRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGGGGGASGGGANS- 191

  Fly   256 HQLPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQ----------SQAAAAAAVNNQGQQQGQAP 310
                   .|:.....|..|.  ||... .:||.|.          .:||||||.:...:|.|.| 
Human   192 -------KPAQKKSCGSKVA--GGAGG-GVSKPHAKLILAGGGGGGKAAAAAAASFAAEQAGAA- 245

  Fly   311 PQLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPG 355
             .|.|...::.:..:|.. ..||..|:.|:.|:.   |::.::||
Human   246 -ALLPLGAAADHHSLYKA-RTPSASASASSAASA---SAALAAPG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 47/70 (67%)
SOX4NP_003098.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 14/59 (24%)
SOX-TCF_HMG-box 58..129 CDD:238684 47/70 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..228 27/110 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..286 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.