DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D and sox5

DIOPT Version :9

Sequence 1:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_021330769.1 Gene:sox5 / 567413 ZFINID:ZDB-GENE-000607-13 Length:763 Species:Danio rerio


Alignment Length:443 Identity:99/443 - (22%)
Similarity:144/443 - (32%) Gaps:179/443 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGQAQGLEDYAPQ-SQLQLSPG----------------------------------MDMDIKRVL 43
            ||..|..:.||.| :.:|:|||                                  .|...:.:.
Zfish   329 LGPLQLQQLYAAQLAAMQVSPGAKHSTVPQANLATGTLSPTSGQSEKNRSTPPPKPKDEGAQPLN 393

  Fly    44 HYSQSLAAMGGSPNGPAGQGVNGSSGMGHHMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQ 108
            ..|:..|:...||..||...|.... :|.....|..|..:....|...::...|||.|||.|...
Zfish   394 LSSKPKASESKSPTSPASPQVPALK-LGPGSLKHSAPSSIGGPPSRLSSIDLLSSITSAGYLNDH 457

  Fly   109 SSL--------------------------GSNGSGLNSSSGH-----QSAGMHSLAT-------- 134
            .::                          ..|...||:....     :.|.:.||:.        
Zfish   458 EAVTKAFQEARKMKEQLKREEQVLDAKVAAVNSLSLNNGRSEKVRFMEKAALESLSQQLKQSEES 522

  Fly   135 -----------------SP---------------GQEGHIKRPMNAFMVWSRLQRRQIAKDNPKM 167
                             ||               ..|.||||||||||||::.:||:|.:..|.|
Zfish   523 KFTHAMMDFGISGDSDGSPSVSDSRIFREARGRGSSEPHIKRPMNAFMVWAKDERRKILQAFPDM 587

  Fly   168 HNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRK---------------- 216
            |||.|||.||:.||.:...||:|:.:|..||...|::::|||||:||.|                
Zfish   588 HNSNISKILGSRWKSMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPKRTCLVDGKKLRIGEYK 652

  Fly   217 ---------PKNPLTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQGY 272
                     .:...|.|.|..|.:.:.|:      ..|||.:....|..|:     ||.|     
Zfish   653 AIMRNRRQEMRQYFTVGQQAQLPLSSAGV------VYPGALSMAGMPSPQM-----PSEH----- 701

  Fly   273 PVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSGI 325
                                           .....:|..:||||.:|::..:
Zfish   702 -------------------------------SSMSSSPEPVPPTSQASYFKEV 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 38/70 (54%)
sox5XP_021330769.1 SSL_OB 332..>415 CDD:332684 15/82 (18%)
SOX-TCF_HMG-box 561..632 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.